Team:Freiburg/Description

From 2011.igem.org

(Difference between revisions)
(The λ lysis genes)
(Part design)
Line 22: Line 22:
{| border=1 align="center"  style="color:black; background-color:#ffffcc;" width="100%" cellpadding="10%" cellspacing="0" border="1"
{| border=1 align="center"  style="color:black; background-color:#ffffcc;" width="100%" cellpadding="10%" cellspacing="0" border="1"
-
| style="width: 50%;background-color:#E6E6E6;" | '''Protein sequence''' <br> <span style="color:violet;">
+
| style="width: 50%;background-color:lightgrey;" | '''Protein sequence''' <br> <span style="color:violet;">
'''CPSRCSCSGTEIRCNSKGLTSVPTGIPSS''' <br>
'''CPSRCSCSGTEIRCNSKGLTSVPTGIPSS''' <br>
'''ATRLELESNKLQSLPHGVFDK''' </span><br><span style="color:green;">
'''ATRLELESNKLQSLPHGVFDK''' </span><br><span style="color:green;">
Line 34: Line 34:
'''LTSLQKIWLHTNPWDCSCPRIDY'''<br>
'''LTSLQKIWLHTNPWDCSCPRIDY'''<br>
'''LSRWLNKNSQKEQGSAKCSGSGKPVRSIICP''' <br></span>
'''LSRWLNKNSQKEQGSAKCSGSGKPVRSIICP''' <br></span>
-
| style="width: 50%;background-color:#E6E6E6;" |  
+
| style="width: 50%;background-color:lightgrey;" |  
<html><iframe align="center" width="400" height="320" src="http://www.youtube.com/embed/fPS51sf77Js?hl=de&fs=1" frameborder="1" allowfullscreen></iframe></html>  
<html><iframe align="center" width="400" height="320" src="http://www.youtube.com/embed/fPS51sf77Js?hl=de&fs=1" frameborder="1" allowfullscreen></iframe></html>  
|-
|-
Line 53: Line 53:
We only submitted one of the three versions, to reduce redundancy in the registry. Please contact us for any questions.
We only submitted one of the three versions, to reduce redundancy in the registry. Please contact us for any questions.
-
 
==Plastic binding domain==
==Plastic binding domain==

Revision as of 21:44, 19 September 2011


This is the wiki page
of the Freiburger student
team competing for iGEM 2011.
Thank you for your interest!